129361-APC

MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated Protein 1 Light Chain 3 beta, MAP1ALC3) (APC)

Größe

£927.00

SKU:: 129361-APC
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-71 from human MAP1LC3B with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E11
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Microtubule-associated protein 1 light chain 3 (LC3) is a fibronectin mRNA-binding protein linked to mRNA translation. Three human isoforms of MAP1-LC3 have been cloned and characterized (MAP1- LC3A, -B, -C). These isoforms differ in their post-translation modification. MAP-LC3 proteins are related to cell growth, differentiation and migration in development and in diseases. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.