MAP Kinase 4 (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4)

Größe

£685.00

SKU:: 129354
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa42-152, from human MAPK4 (NP_002738) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.