MAGEB6 (Melanoma-associated Antigen B6, Cancer/Testis Antigen 3.4, CT3.4, MAGE-B6 Antigen, FLJ40242)

Größe

£685.00

SKU:: 129324
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa135-245 from human MAGEB6 (NP_775794) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKKACTLAQFLQKKFEKKESILKADMLKCVRREYKPYFPQILNRTSQHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.