129297
MAFA (Transcription Factor MafA, Pancreatic beta-cell-specific Transcriptional Activator, Transcription Factor RIPE3b1, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A)
Größe
£685.00
- SKU:
- 129297
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa222-308 of human MAFA with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2F1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- MafA is a 352aa containing transcription factor playing an important part in the regulation of the insulin gene transcription. It belongs to the bZIP family and Maf subfamily with a bZIP domain and binds DNA as a homodimer. Transcription factor MafA binds to RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene. MafA is known to cooperate synergistically with NEUROD1 and PDX1 and is known to be up-regulated by glucose. It is detected in nuclei of pancreas islet beta cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. AA Sequence: LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice