129297-HRP
MAFA (Transcription Factor MafA, Pancreatic beta-cell-specific Transcriptional Activator, Transcription Factor RIPE3b1, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A) (HRP)
Größe
£914.00
- SKU:
- 129297-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa222-308 of human MAFA with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2F1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- MafA is a 352aa containing transcription factor playing an important part in the regulation of the insulin gene transcription. It belongs to the bZIP family and Maf subfamily with a bZIP domain and binds DNA as a homodimer. Transcription factor MafA binds to RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene. MafA is known to cooperate synergistically with NEUROD1 and PDX1 and is known to be up-regulated by glucose. It is detected in nuclei of pancreas islet beta cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice