129252-ML490
LY-6H (Lymphocyte Antigen 6H, LY6H, NMLY6, Lymphocyte Antigen 6 Complex, Locus H) (MaxLight 490)
Größe
£914.00
- SKU:
- 129252-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa26-140 from human LY6H (AAH28894) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. The LY6 antigens are a family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY-6H belongs to the LY6 family and it encodes a 140aa polypeptide that is 23-33% identical to other known family members. LY-6H is higly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in the acute leukemic cell line MOLt-3. It is also expressed at lower levels in testis, small intestine and colon. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice