LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC)

Größe

£685.00

SKU:: 129187
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa657-756 from human LOXL4 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May modulate the formation of a collagenous extracellular matrix. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.