129186-ML490
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 490)
Größe
£914.00
- SKU:
- 129186-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa675-773 from human LOXL2 (NP_002309) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5D2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Lysyl Oxidase (LO) is an extracellular, copper-dependent enzyme that initiates the cross-linking of collagens and elastin by catalyzing the oxidative deamination of peptidyl lysine to alpha-aminoadipic-delta-semialdehyde. Members of LO family have diverse functions which include tumor suppression and cell adhesion and senescence. LOXL2, a 87kD protein, is a novel member of this family. It contains 3 potential N-linked glycosylation sites, 4 scavenger receptor cysteine-rich (SRCR) domains and highly conserved copper-binding and Lysyl-tyrosylquinone cofactor sites. It is a component of extracellular matrix that might be involved in cell adhesion and senescence. Role of LOXL2 has been implicated in malignant transformation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice