LMOD1 (Leiomodin 1, Leiomodin-1, 64kD Autoantigen 1D, 64kD Autoantigen 1D3, 64kD Autoantigen D1, FLJ55689, Leiomodin Muscle Form, Smooth Muscle Leiomodin, SM-Lmod, Thyroid-associated Ophthalmopathy Autoantigen)

Größe

£685.00

SKU:: 129146
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-270 from LMOD1 (AAH01755) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.