LMO1 (Rhombotin-1, Cysteine-rich Protein TTG-1, LIM Domain Only Protein 1, LMO-1, T-cell Translocation Protein 1, RBTN1, RHOM1, TTG1, MGC116692)

Größe

£685.00

SKU:: 129139
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-90 from human LMO1 (NP_002306) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.