129126-BIOTIN
LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Biotin)
Größe
£914.00
- SKU:
- 129126-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-91 from human BIRC7 (NP_647478) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3H1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Livin is a member of IAP family characterized by the presence of an N-terminal, conserved, single BIR domain and a C-terminal RING-type zinc finger domain. It plays a vital role in caspase regulation, anti-apoptosis and tumorigenesis. Livin interacts with diverse pro-apoptotic factors and inhibits apoptosis triggered by various death stimuli in a caspase-dependent and caspase-independent methods. BIR domain of Livin binds to caspase-9, inhibits its proteolysis and induces a caspase-dependent anti-apoptotic cascade. Alternatively, Livin has also been found to activate MAP kinase and inhibit apoptosis via TAK1/JNK1 signaling cascade. Northern Blot analysis detected an elevated expression in developmental tissues and human melanomas, suggesting a potential cancer target. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice