129124-BIOTIN
LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor, LPS-induced TNF-alpha Factor, Small Integral Membrane Protein of Lysosome/Late Endosome, p53-induced Gene 7 Protein, PIG7, SIMPLE) (Biotin)
Größe
£914.00
- SKU:
- 129124-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-161 from LITAF (NP_004853) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Lipopolysaccharide-induced tumor necrosis factor-alpha factor(LITAF) mediates the expression of inflammatory cytokines such as TNF-alpha in Lipopolysaccharide-induced processes. LITAF binds to STAT6B, a member of the STAT6 family forming a complex on the TNF-alpha promoter that modulates TNF activity. High levels of expression of LITAF mRNA have been observed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice