129123-ML550
LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor, LPS-induced TNF-alpha Factor, Small Integral Membrane Protein of Lysosome/Late Endosome, p53-induced Gene 7 Protein, PIG7, SIMPLE) (MaxLight 550)
Größe
£934.00
- SKU:
- 129123-ML550
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human LITAF, aa1-161 (NP_004853.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Lipopolysaccharide-induced tumor necrosis factor-alpha factor(LITAF) mediates the expression of inflammatory cytokines such as TNF-alpha in Lipopolysaccharide-induced processes. LITAF binds to STAT6B, a member of the STAT6 family forming a complex on the TNF-alpha promoter that modulates TNF activity. High levels of expression of LITAF mRNA have been observed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice