129077-BIOTIN
LGR7 (Relaxin Receptor 1, Leucine-rich Repeat-containing G-protein Coupled Receptor 7, Relaxin Family Peptide Receptor 1, RXFP1, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177) (Biotin)
Größe
£914.00
- SKU:
- 129077-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa68-163 from human LGR7 (NP_067647) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- LGR7 is a member of the Relaxin Receptor subfamily. LGR7 has been reported in adrenal, brain, colon, heart, kidney, liver, lung, ovary, placenta, prostate, salivary gland, small intestine, testis, and uterus. ESTs have been isolated from melanocyte/uterus/fetal heart and skeletal muscle libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice