LDLR (Low-density Lipoprotein Receptor, LDL Receptor)

Größe

£685.00

SKU:: 129047
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa105-205 from human LDLR (NP_000518) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: LDL R is the prototype low density lipoprotein receptor. It is a transmembrane protein that plays a role in cholesterol homeostasis by mediating the uptake of low density lipoproteins. Some of the many allelic variants of LDL R cause familial hypercholesterolemia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.