LDHB (L-lactate Dehydrogenase B Chain, LDH-B, LDH Heart Subunit, LDH-H, Renal Carcinoma Antigen NY-REN-46)

Größe

£685.00

SKU:: 129039
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-334 from human LDHB with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Lactate dehydrogenase (LDH) is present in a wide variety of organisms, including plants and animals. It is an oxidoreductase which catalyses the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+. As it can also catalyze the oxidation of hydroxybutyrate, it is occasionally called Hydroxybutyrate Dehydrogenase (HBD). There are 5 different isoenzymes of LDH, LDH1 to LDH5, each composed of 4 subunits which may be of 2 different types-M and H subunits. These subunits are encoded by two different genes: The M subunit is encoded by gene LDHA whilst the H subunit is encoded by LDHB. Usually LDH2 is the predominant form in the serum. An LDH1 level higher than the LDH2 level suggests myocardial infarction (damage to heart tissues releases heart LDH, which is rich in LDH1, into the bloodstream). Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 5ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice