129039-APC
LDHB (L-lactate Dehydrogenase B Chain, LDH-B, LDH Heart Subunit, LDH-H, Renal Carcinoma Antigen NY-REN-46) (APC)
Größe
£927.00
- SKU:
- 129039-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-334 from human LDHB with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2H6
- Format:
- Supplied as a liquid in PBS, pH 7.4. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Lactate dehydrogenase (LDH) is present in a wide variety of organisms, including plants and animals. It is an oxidoreductase which catalyses the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+. As it can also catalyze the oxidation of hydroxybutyrate, it is occasionally called Hydroxybutyrate Dehydrogenase (HBD). There are 5 different isoenzymes of LDH, LDH1 to LDH5, each composed of 4 subunits which may be of 2 different types-M and H subunits. These subunits are encoded by two different genes: The M subunit is encoded by gene LDHA whilst the H subunit is encoded by LDHB. Usually LDH2 is the predominant form in the serum. An LDH1 level higher than the LDH2 level suggests myocardial infarction (damage to heart tissues releases heart LDH, which is rich in LDH1, into the bloodstream). Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice