129015-BIOTIN
LAT (Linker for Activation of T-cells Family Member 1, 36kD Phospho-tyrosine Adapter Protein, pp36, p36-38) (Biotin)
Größe
£914.00
- SKU:
- 129015-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-234 from human LAT (AAH11563) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B11-1D5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- LAT is a transmembrane molecule that mediates signaling following the engagement of a number of cell surface receptors including TCR during mature T cell activation, pre-TCR during T cell development, Fc RIII on NK cells, and FceRI on mast cells. LAT is multiply phosphorylated on tyrosines by ZAP-70 and Syk, which leads to downstream effects that include release of intracellular calcium, PKC activation, MAPK activation and cytoskeletal reorganization. Palmitoylation of LAT is required for its localization to lipid rafts and efficient phosphorylation. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice