129014-ML490
LASS6 (LAG1 Longevity Assurance Homolog 6, LAG1 Homolog Ceramide Synthase 6, CerS6, MGC129949, MGC129950) (MaxLight 490)
Größe
£914.00
- SKU:
- 129014-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa62-132 from human LASS6 (NP_982288) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5H7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. LASS6 may be involved in sphingolipid synthesis or its regulation (By similarity). Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detected LASS6 using immunoperoxidase staining on formalin-fixed paraffin-embedded human colon. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice