129014-BIOTIN
LASS6 (LAG1 Longevity Assurance Homolog 6, LAG1 Homolog Ceramide Synthase 6, CerS6, MGC129949, MGC129950) (Biotin)
Größe
£914.00
- SKU:
- 129014-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa62-132 from human LASS6 (NP_982288) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5H7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- LASS6 may be involved in sphingolipid synthesis or its regulation (By similarity). Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detected LASS6 using immunoperoxidase staining on formalin-fixed paraffin-embedded human colon. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice