128993
Laminin, beta 3 (Laminin Subunit beta-3, LAMB3, BM600-125kDa, FLJ99565, Epiligrin Subunit bata, Laminin-5 Subunit beta, LAM5, Kalinin Subunit beta, Nicein Subunit beta, Laminin B1k Chain, LAMNB1, Kalinin B1 Chain)
Größe
£685.00
- SKU:
- 128993
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1064-1171 from human LAMB3 (NP_000219) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G10
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice