LAMC1 (Laminin Subunit gamma-1, Laminin B2 Chain, Laminin-1 Subunit gamma, Laminin-10 Subunit gamma, Laminin-11 Subunit gamma, Laminin-2 Subunit gamma, Laminin-3 Subunit gamma, Laminin-4 Subunit gamma, Laminin-6 Subunit gamma, Laminin-7 Subunit gamma, Laminin-8 Subunit gamma, Laminin-9 Subunit gamma, S-laminin Subunit gamma, S-LAM gamma, Laminin B2, gamma1, LAMB2, MGC87297)

Größe

£685.00

SKU:: 128992
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-38 from human LAMC1 (AAH15586) with GST tag. MW of the GST tag alone is 26kD.
Klon:: M1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Laminins are large heterotrimeric, non-collagenous glycoproteins composed of alpha, beta, and gamma chains. They are ubiquitously present in basement membrane (BM) along with entactin/nidogen (EN), collagen type IV (CIV), large heparan sulfate proteoglycan (HSPG), which interact specifically with each other to form a continuous and regular BM. Alterations of BM integrity, from local discontinuities up to complete loss, are described in many types of human and animal epithelial neoplasms. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.