128992-BIOTIN
LAMC1 (Laminin Subunit gamma-1, Laminin B2 Chain, Laminin-1 Subunit gamma, Laminin-10 Subunit gamma, Laminin-11 Subunit gamma, Laminin-2 Subunit gamma, Laminin-3 Subunit gamma, Laminin-4 Subunit gamma, Laminin-6 Subunit gamma, Laminin-7 Subunit gamma, Laminin-8 Subunit gamma, Laminin-9 Subunit gamma, S-laminin Subunit gamma, S-LAM gamma, Laminin B2, gamma1, LAMB2, MGC87297) (Biotin)
Größe
£914.00
- SKU:
- 128992-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-38 from human LAMC1 (AAH15586) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- M1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Laminins are large heterotrimeric, non-collagenous glycoproteins composed of alpha, beta, and gamma chains. They are ubiquitously present in basement membrane (BM) along with entactin/nidogen (EN), collagen type IV (CIV), large heparan sulfate proteoglycan (HSPG), which interact specifically with each other to form a continuous and regular BM. Alterations of BM integrity, from local discontinuities up to complete loss, are described in many types of human and animal epithelial neoplasms. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice