KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA)

Größe

£685.00

SKU:: 128928
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa387-496 from human KRT1 (NP_006112) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May regulate the activity of kinases such as PKC and SRC via binding to integrin beta-1 (ITB1) and the receptor of activated protein kinase C (RACK1/GNB2L1). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.