KNG1 (BDK, KNG, Kininogen-1, Alpha-2-thiol Proteinase Inhibitor, Fitzgerald Factor, High Molecular Weight Kininogen, Williams-Fitzgerald-Flaujeac Factor, Kininogen-1 Heavy Chain, T-kinin, Ile-Ser-Bradykinin, Bradykinin, Kallidin I, Lysyl-bradykinin, Kallidin II, Kininogen-1 Light Chain, Low Molecular Weight Growth-promoting Factor)

Größe

£685.00

SKU:: 128910
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa322-427 from human KNG1 (NP_000884.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.