128905-BIOTIN
KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1, 2F1-Ag, Mast Cell Function-associated Antigen 2F1, MAFA, MAFA-L, MGC123930) (Biotin)
Größe
£934.00
- SKU:
- 128905-BIOTIN
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full-length human KLRG1, aa1-207 (NP_005801.3).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- KLRG1 (killer cell lectin-like receptor G1), is the mouse homolog of the rat mast cell function-associated antigen (MAFA). It is expressed by activated CD8 T-cells and by a large proportion of natural killer (NK) cells. It is not found in the spleen, thymus, lymph nodes, testis, brain or kidney and is not expressed on mast cell lines, bone-marrow-derived mast cells or peritoneal mast cells. T-cells expressing KLRG1 have greatly reduced proliferation potential, but are not limited in their capacity to perform immediate effector cell functions, such as the secretion of gamma interferon. KLRG1 plays an inhibitory role on NK cells and T-cells by binding to their ligands. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice