KLRA1 (Killer Cell Lectin-Like Receptor Subfamily A, Member 1, KLRA#, LY49L, Ly-49L, Ly49, MGC126520, MGC126522)

Größe

£685.00

SKU:: 128897
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa66-171 from human KLRA1 (NP_006602) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: KLRA1 is one of a cluster of lectin genes. It is likely to represent an evolutionarily remnant. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.