128887
KLK3 (APS, Prostate-specific Antigen, PSA, Gamma-seminoprotein, Seminin, Kallikrein-3, P-30 Antigen, Semenogelase)
Größe
£685.00
- SKU:
- 128887
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-261 from human KLK3 (AAH05307) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. KLK 3 (also known as prostate specific antigen) is a marker for prostatic cancer and is involved in the pathogenesis and/or progression of prostate, breast, and possibly other malignancies. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice