KLF9 (Krueppel-like Factor 9, Basic Transcription Element-binding Protein 1, BTE-binding Protein 1, GC-box-binding Protein 1, Transcription Factor BTEB1, BTEB, BTEB1)

Größe

£685.00

SKU:: 128862
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa25-101 from human KLF9 (NP_001197) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.