128854
KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF)
Größe
£685.00
- SKU:
- 128854
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa263-350 from KLF2 (NP_057354) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- KLF2 (Kruppel-like factor 2; endothelium, monocytes, Taa in length. It contains an activation domain aa1-110, an inhibitory domain aa111-267, and three C2H2-type zinc-finger regions aa272-354. There is one potential splice form that shows a premature truncation after Asp224. Over aa71-168, human KLF2 is 82aa identical to mouse KLF2. also LKLF) is a lung-associated, 37kD member of the Kruppel C2H2-type zinc-finger protein family. KLF2 is found in airway epithelium, and B cells. It is a transcription factor that regulates multiple genes, many of which are involved in cell migration. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice