128854-ML490
KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (MaxLight 490)
Größe
£914.00
- SKU:
- 128854-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa263-350 from KLF2 (NP_057354) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. KLF2 (Kruppel-like factor 2; endothelium, monocytes, Taa in length. It contains an activation domain aa1-110, an inhibitory domain aa111-267, and three C2H2-type zinc-finger regions aa272-354. There is one potential splice form that shows a premature truncation after Asp224. Over aa71-168, human KLF2 is 82aa identical to mouse KLF2. also LKLF) is a lung-associated, 37kD member of the Kruppel C2H2-type zinc-finger protein family. KLF2 is found in airway epithelium, and B cells. It is a transcription factor that regulates multiple genes, many of which are involved in cell migration. Applications: Suitable for use in Western Blot and FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice