128854-BIOTIN
KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (Biotin)
Größe
£914.00
- SKU:
- 128854-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa263-350 from KLF2 (NP_057354) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- KLF2 (Kruppel-like factor 2; endothelium, monocytes, Taa in length. It contains an activation domain aa1-110, an inhibitory domain aa111-267, and three C2H2-type zinc-finger regions aa272-354. There is one potential splice form that shows a premature truncation after Asp224. Over aa71-168, human KLF2 is 82aa identical to mouse KLF2. also LKLF) is a lung-associated, 37kD member of the Kruppel C2H2-type zinc-finger protein family. KLF2 is found in airway epithelium, and B cells. It is a transcription factor that regulates multiple genes, many of which are involved in cell migration. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice