128847-ML550
KLF10 (Krueppel-like Factor 10, EGR-alpha, Transforming Growth Factor-beta-inducible Early Growth Response Protein 1, TGFB-inducible Early Growth Response Protein 1, TIEG-1, TIEG, TIEG1) (MaxLight 550)
Größe
£914.00
- SKU:
- 128847-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from human KLF10 (AAH11538) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4G9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. KLF10 is a nuclear protein belonging to the Sp1 C2H2-type zinc-finger protein family with three C2H2-type zinc fingers. KLF10 is a transcriptional repressor involved in the regulation of cell growth and inhibits cell growth. It binds to the consensus sequence 5'-GGTGTG-3' and is induced by TGF-beta thus playing a role in linking TGF-beta-mediated signaling cascades to the regulation of pancreatic epithelial cell growth. KLF10 is involved in inducing and promoting apoptosis through the mitochondrial apoptotic pathway and may inhibit Smad7 expression in bronchial epithelial cells. Ubiquitous expression of KLF10 is seen in most of the tissues. Reports suggest that it may mediate up-regulation of TGFBI in VHL-deficient tumors and other cancers. Over expression of KLF10 may be associated with renal clear cell carcinoma and other tumors. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice