128847-BIOTIN

KLF10 (Krueppel-like Factor 10, EGR-alpha, Transforming Growth Factor-beta-inducible Early Growth Response Protein 1, TGFB-inducible Early Growth Response Protein 1, TIEG-1, TIEG, TIEG1) (Biotin)

Größe

£914.00

SKU:: 128847-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human KLF10 (AAH11538) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: KLF10 is a nuclear protein belonging to the Sp1 C2H2-type zinc-finger protein family with three C2H2-type zinc fingers. KLF10 is a transcriptional repressor involved in the regulation of cell growth and inhibits cell growth. It binds to the consensus sequence 5'-GGTGTG-3' and is induced by TGF-beta thus playing a role in linking TGF-beta-mediated signaling cascades to the regulation of pancreatic epithelial cell growth. KLF10 is involved in inducing and promoting apoptosis through the mitochondrial apoptotic pathway and may inhibit Smad7 expression in bronchial epithelial cells. Ubiquitous expression of KLF10 is seen in most of the tissues. Reports suggest that it may mediate up-regulation of TGFBI in VHL-deficient tumors and other cancers. Over expression of KLF10 may be associated with renal clear cell carcinoma and other tumors. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice