KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850)

Größe

£685.00

SKU:: 128840
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa679-779 from human KIRREL3 (NP_115920) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Could be involved in the hematopoietic supportive capacity of stroma cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.