128833-ML490
KIR2DL5 (Killer Cell Immunoglobulin-like Receptor 2DL5A, CD158f1, KIR2DL5A, CD158F, CD158F1) (MaxLight 490)
Größe
£934.00
- SKU:
- 128833-ML490
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human KIR2DL5A, aa1-375 (AAI60063.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. KIR2DL5 is the most recently identified human killer cell immunoglobulin-like receptors (KIR), which are transmembrane glycoproteins expressed by natural killer cells (NK) and subsets of T cells. KIR2DL5 is a type II member of the KIR2D family with two extracellular Ig-like domains of the D0 and D2 type. Its structure is expressed by 50% of humans and is conserved among primate species. Its gene localized on human chromosome 19p13.3, is restricted to the B subset of KIR haplotypes. The protein is represented in the human genome by two genes, KIR2DL5A and KIR2DL5B that show 99.5-99.7% identity in their coding sequences. The protein acts as a receptor on NK cells for HLA-C alleles, inhibits the activity of NK cell and thus plays a specialized role in innate immunity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice