Ki-67 (Antigen Identified by Monoclonal Antibody Ki-67, Antigen KI-67, KIA, MKI67)

Größe

£685.00

SKU:: 128783
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa3157-3256 from human MKI67 (NP_002408) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Ki67 is a cell cycle associated protein expressed from G1 through the end of M phase. This antibody will help detect the Ki67 antigen and may be useful in the assessment of cell proliferation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKITTRSHRDSEDI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.