128775
Keratin 7 (Keratin Type II Cytoskeletal 7, Keratin-7, K7, KRT7, Cytokeratin-7, CK7, CK-7, K2C7, MGC3625, MGC129731, Sarcolectin, SCL, Type-II Keratin Kb7)
Größe
£760.00
- SKU:
- 128775
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human KRT7, aa1-469 (AAH02700.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Cytokeratin 7 was found to occur in the columnar and glandular epithelium of the lung, cervix, breast, bile ducts, larger collecting ducts of the kidney and in mesothelium, but is absent from gastrointestinal epithelium, hepatocytes and myoepithelium. Several types of adenocarcinomas of the gastrointestinal tract and of the urinary tract are negative, while adenocarcinomas of the mammary gland, ovary and lung are positive. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice