128750-FITC

KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2) (FITC)

Größe

£914.00

SKU:: 128750-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa439-539 from human KCNK10 (NP_066984) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.