KBTBD10 (KRP1, Kelch Repeat and BTB Domain-containing Protein 10, Kel-like Protein 23, Kelch-related Protein 1, Sarcosin)

Größe

£685.00

SKU:: 128729
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa205-304 from human KBTBD10 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.