128716-HRP

KAP-1 (Transcription Intermediary Factor 1-beta, TIF1-beta, E3 SUMO-protein Ligase TRIM28, KRAB-associated Protein 1, KRAB-interacting Protein 1, KRIP-1, Nuclear Corepressor KAP-1, RING Finger Protein 96, Tripartite Motif-containing Protein 28, TRIM28, KAP1, RNF96, TIF1B) (HRP)

Größe

£914.00

SKU:: 128716-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa379-524 from TRIM28 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).
Weitere Details:: TIF1beta is a member of the Transcriptional Intermediary Factor 1 (TIF1) subfamily. TIF1beta contains a RING finger, B box, Coiled coil, PHD/TTC, and bromodomain. TIF1beta is a corepressor for Kruppel-associated box (KRAB)-domain-containing zinc finger proteins and plays a critical role in early embryogenesis. TIF1beta acts as a transcriptional mediator by binding liganded nuclear receptors, including retinoic acid (RAR), retinoid X (RXR) and estrogen (ER) receptors. TIF1beta associates with both heterochromatin and euchromatin, causing gene silencing by both HP1 binding and histone deacetylation. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice