128716-BIOTIN

KAP-1 (Transcription Intermediary Factor 1-beta, TIF1-beta, E3 SUMO-protein Ligase TRIM28, KRAB-associated Protein 1, KRAB-interacting Protein 1, KRIP-1, Nuclear Corepressor KAP-1, RING Finger Protein 96, Tripartite Motif-containing Protein 28, TRIM28, KAP1, RNF96, TIF1B) (Biotin)

Größe

£914.00

SKU:: 128716-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa379-524 from TRIM28 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: TIF1beta is a member of the Transcriptional Intermediary Factor 1 (TIF1) subfamily. TIF1beta contains a RING finger, B box, Coiled coil, PHD/TTC, and bromodomain. TIF1beta is a corepressor for Kruppel-associated box (KRAB)-domain-containing zinc finger proteins and plays a critical role in early embryogenesis. TIF1beta acts as a transcriptional mediator by binding liganded nuclear receptors, including retinoic acid (RAR), retinoid X (RXR) and estrogen (ER) receptors. TIF1beta associates with both heterochromatin and euchromatin, causing gene silencing by both HP1 binding and histone deacetylation. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice