128714-FITC
Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (FITC)
Größe
£914.00
- SKU:
- 128714-FITC
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa194-293 from human Kallikrein 5 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3H3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel KLK gene, KLK12, is expressed in a variety of tissues including salivary gland, stomach, uterus, lung, thymus, prostate, colon, brain, breast, thyroid, and trachea. It has applications as a novel cancer biomarker. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANSQANS* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice