JMJD1C (Probable JmjC Domain-containing Histone Demethylation Protein 2C, Jumonji Domain-containing Protein 1C, Thyroid Receptor-interacting Protein 8, TR-interacting Protein 8, TRIP-8, JHDM2C, KIAA1380, TRIP8, DKFZp761F0118, FLJ14374, RP11-10C13.2)

Größe

£685.00

SKU:: 128682
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-99, from human JMJD1C with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5F12
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.