ITGA6 (Integrin alpha-6, VLA-6, CD49 Antigen-like Family Member F, CD49f, DKFZp686J01244, FLJ18737)

Größe

£685.00

SKU:: 128628
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa24-133 from human ITGA6 (NP_000201) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Integrins are a family of heterodimeric membrane glycoproteins consisting on non-covalently associated alpha and beta subunits. In general, integrins function as receptors for extracellular matrix proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRGEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.