IRF4 (Multiple Myeloma Oncogene 1, NF-EM5, Lymphocyte-specific Interferon Regulatory Factor, LSIRF, Interferon Regulatory Factor 4, IRF-4, IRF4, MUM1, FLJ14868, FLJ22283, HSPC211, MGC131891, MGC163315, MUM-1)

Größe

£685.00

SKU:: 128588
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa342-451 from human IRF4 (NP_002451) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: IRF4 is a transcriptional activator. It Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter and binds the immunoglobulin lambda light chain enhancer, together with PU.1. This protein probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.