128588-BIOTIN
IRF4 (Multiple Myeloma Oncogene 1, NF-EM5, Lymphocyte-specific Interferon Regulatory Factor, LSIRF, Interferon Regulatory Factor 4, IRF-4, IRF4, MUM1, FLJ14868, FLJ22283, HSPC211, MGC131891, MGC163315, MUM-1) (Biotin)
Größe
£914.00
- SKU:
- 128588-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa342-451 from human IRF4 (NP_002451) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- IRF4 is a transcriptional activator. It Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter and binds the immunoglobulin lambda light chain enhancer, together with PU.1. This protein probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice