IQCH (IQ Domain-containing Protein H, Testis Development Protein NYD-SP5, DKFZp434F2114, FLJ12476, NYDSP5)

Größe

£685.00

SKU:: 128562
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa301-401 from human IQCH (NP_073621) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May play a regulatory role in spermatogenesis. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.