128551-BIOTIN
Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derived Neutrophil Chemotactic Factor, MDNCF, Neutrophil Activating Factor, NAF, Neutrophil Activating Peptide 1, Neutrophil Activating Protein 1, NAP-1, NAP1, Protein 3-10C, SCYB8, T cell Chemotactic Factor, TSG1) (Biotin)
Größe
£914.00
- SKU:
- 128551-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa21-99 from IL8 (AAH13615.1) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6D12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- IL-8, also known as CXCL8, is produced by a range of cells including stimulated monocytes, mast cells, endothelial cells, keratinocytes and fibroblasts. IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice