INPP5A (Type I Inositol 1,4,5-trisphosphate 5-phosphatase, 5PTase, DKFZp434A1721, MGC116947, MGC116949)

Größe

£685.00

SKU:: 128526
Reinheit:: Purified by Protein A affinity chromatography
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa288-387 from human INPP5A with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D8
Format:: Supplied as a liquid in PBS, pH 7.4
Weitere Details:: Major isoenzyme hydrolyzing the calcium-mobilizing second messenger Ins(1,4,5)P3, this is a signal-terminating reaction. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.